PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_3463CAE33.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 230aa    MW: 25604.7 Da    PI: 9.8482
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_3463CAE33.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.63.6e-1077125553
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                            kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +++
  Traes_7DS_3463CAE33.1  77 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMMQ 125
                            899**************************************99887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-1873137IPR004827Basic-leucine zipper domain
PfamPF077162.0E-974126IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.47375138IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.45E-1277127No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-1177132No hitNo description
CDDcd147035.74E-1978127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDSFMGKLNY ATGDDSPKLP LPSPSGGLSR SGSGSLDGGG AASLFGTEFA NGEFTEAEKK  60
KIMANERLAE IALTDPKRVK RILANRQSAA RSKERKMRYI QELEHKVQVL QTEATTLSAQ  120
LTMMQRDSGG LATQNNELKI RLQAMEQQAQ LRDALNEALT GEVQRLKLAT GEITDARMSK  180
AGLQQQMNSQ LIQMQQLQIQ QQQQQQSSQT QQAQQQQQQQ QQQQQQQSQQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9843780.0GU984378.1 Triticum aestivum cultivar CB037 bZiP-like trancription factor (SF) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001170295.11e-112uncharacterized protein LOC100384258
SwissprotQ6S4P46e-54RF2B_ORYSJ; Transcription factor RF2b
TrEMBLW5I6A31e-161W5I6A3_WHEAT; Uncharacterized protein
STRINGMLOC_75510.11e-137(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-68bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]